| Protein Id: ABA18723.1 |
Length: 164 aa |
| Description: spike protein VP4, partial Human rotavirus A. |
Molecule type: linear |
| Data category: VRL |
Date: 26-Jul-16 |
| Source: Human rotavirus A |
| Class virus: rotavirus |
Virus name: Human rotavirus |
| Host: -- |
Authors: Monnier;N.; Higo-Moriguchi;K.; Sun;Z.Y.; Prasad;B.V.; Taniguchi;K. and Dormitzer;P.R. |
| Title: High-resolution molecular and antigen structure of the VP8* core of a sialic acid-independent human rotavirus strain |
Journal: J Virol 80 (3); 1513-1523 (2006) |
| Taxonomy: Human rotavirus A Viruses; Riboviria; Orthornavirae; Duplornaviricota; Resentoviricetes; Reovirales; Reoviridae; Sedoreovirinae; Rotavirus; Rotavirus A. |
| db_xref: """taxon:10941, CDD:189541""" |
| Sequence: TVEPVLDGPYQPTTFKPPNDYWLLISSNTNGVVYESTNNNDFWTAVIAVEPHVSQTNRQYILFGENKQFNVENNSDKWKFFEMFKGSSQGDFSNRRTLTSSNRLVGMLKYGGRVWTFHGETPRATTDSSNTADLNNISIIIHSEFYIIPRSQESKCNEYINNGL |
Nucleotide
| Nucleotide_Id: DQ141310.1 |
Length: 492bp |
| Description: Human rotavirus A isolate DS-1 segment 4 spike protein VP4 gene; partial cds |
Source: Human rotavirus A |
| Nucleotide_type: RNA |
Molecule type: linear |
| Data category: VRL |
Date: 26-Jul-16 |
| Class virus: rotavirus |
Virus name: Human rotavirus |
| CDS: DQ141310.1:<1..>492 |
Host: -- |
| Authors: Monnier;N.; Higo-Moriguchi;K.; Sun;Z.Y.; Prasad;B.V.; Taniguchi;K. and Dormitzer;P.R. |
Journal: J Virol 80 (3); 1513-1523 (2006) |
| Title: High-resolution molecular and antigen structure of the VP8* core of a sialic acid-independent human rotavirus strain |
db_xref: taxon:10941 |
| Taxonomy: Human rotavirus A Viruses; Riboviria; Orthornavirae; Duplornaviricota; Resentoviricetes; Reovirales; Reoviridae; Sedoreovirinae; Rotavirus; Rotavirus A. |
| Features: SeqFeature(FeatureLocation(ExactPosition(0); ExactPosition(492); strand=1); type='source'); SeqFeature(FeatureLocation(BeforePosition(0); AfterPosition(492); strand=1); type='CDS') |
| Sequence: ACAGTGGAACCAGTTTTAGATGGTCCTTATCAACCCACTACATTCAAACCACCCAATGATTATTGGTTGCTTATTAGTTCAAATACAAATGGAGTAGTCTACGAAAGTACAAATAATAATGACTTTTGGACAGCAGTTATCGCAGTTGAACCACATGTTAGTCAAACAAATAGGCAATATATTTTATTTGGTGAAAATAAGCAGTTTAACGTAGAAAACAATTCAGATAAATGGAAATTTTTCGAAATGTTTAAAGGTAGTAGTCAGGGTGATTTTTCTAATAGACGGACTCTAACTTCTAGTAATAGACTTGTAGGGATGCTAAAATATGGTGGAAGAGTATGGACATTTCATGGTGAAACACCAAGAGCTACTACTGATAGTTCAAATACTGCGGATTTAAATAATATATCAATTATAATTCATTCAGAGTTTTATATTATTCCAAGATCCCAAGAATCTAAATGTAACGAGTATATCAATAATGGTTTA |