Protein

Protein Id:  AAT28311.1 Length:   143 aa
Description:   spike protein subunit 1, partial Bovine coronavirus. Molecule type:   linear
Data category:   VRL Date:   26-Jul-16
Source:   Bovine coronavirus
Class virus:   Coronaviridae Virus name:   Bovine coronavirus
Host:   -- Authors:   Brandao;P.E.; Gregori;F.; Richtzenhain;L.J.; Rosales;C.A.; Villarreal;L.Y. and Jerez;J.A.
Title:   Molecular analysis of Brazilian strains of bovine coronavirus (BCoV) reveals a deletion within the hypervariable region of the S1 subunit of the spike glycoprotein also found in human coronavirus OC43 Journal:   Arch Virol 151 (9); 1735-1748 (2006)
Taxonomy:   Bovine coronavirus Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Embecovirus.
db_xref:   """taxon:11128, CDD:286493"""
Sequence:   PSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGLGIDAGYKNSGIGTCPAGTNYLTCHSLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCTCQPQAFLGWSVDSCL

Nucleotide

Nucleotide_Id:  AY606193.1 Length:   430bp
Description:   Bovine coronavirus strain USP-03 spike protein subunit 1 (S1) gene; partial cds Source:   Bovine coronavirus
Nucleotide_type:   RNA Molecule type:   linear
Data category:   VRL Date:   26-Jul-16
Class virus:   Coronaviridae Virus name:   Bovine coronavirus
CDS:   AY606193.1:<1..>430 Host:   --
Authors:   Brandao;P.E.; Gregori;F.; Richtzenhain;L.J.; Rosales;C.A.; Villarreal;L.Y. and Jerez;J.A. Journal:   Arch Virol 151 (9); 1735-1748 (2006)
Title:   Molecular analysis of Brazilian strains of bovine coronavirus (BCoV) reveals a deletion within the hypervariable region of the S1 subunit of the spike glycoprotein also found in human coronavirus OC43 db_xref:   taxon:11128
Taxonomy:   Bovine coronavirus Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Embecovirus.
Features:   SeqFeature(FeatureLocation(ExactPosition(0); ExactPosition(430); strand=1); type='source'); SeqFeature(FeatureLocation(BeforePosition(0); AfterPosition(430); strand=1); type='gene'); SeqFeature(FeatureLocation(BeforePosition(0); AfterPosition(430); strand=1); type='CDS')
Sequence:   TCCTTCTACTTGGAATAGGAGATTTGGTTTTACAGAACAATCTGTTTTTAAGCCTCAACCTGTAGGTGTTTTTACTCATCATGATGTTGTTTATGCACAACATTGTTTTAAAGCTCCCACAAATTTCTGTCCGTGTAAATTGGATGGGTCTTTGTGTGTAGGTAATGGTCTTGGTATAGATGCTGGTTATAAAAATAGTGGTATAGGCACTTGTCCTGCAGGTACTAATTATTTAACTTGCCATAGTTTGTGCACTCCCGACCCCATTACATCTAAATCTACAGGGCCTTACAAGTGCCCCCAAACTAAATACTTAGTTGGCATAGGTGAGCACTGTTCGGGTCTTGCTATTAAAAGTGATTATTGTGGAGGTAATCCTTGTACTTGCCAACCACAAGCATTTTTGGGTTGGTCTGTTGACTCTTGTTTA