Protein Id: AAT28313.1 |
Length: 131 aa |
Description: spike protein subunit 1, partial Bovine coronavirus. |
Molecule type: linear |
Data category: VRL |
Date: 26-Jul-16 |
Source: Bovine coronavirus |
Class virus: Coronaviridae |
Virus name: Bovine coronavirus |
Host: -- |
Authors: Brandao;P.E.; Gregori;F.; Richtzenhain;L.J.; Rosales;C.A.; Villarreal;L.Y. and Jerez;J.A. |
Title: Molecular analysis of Brazilian strains of bovine coronavirus (BCoV) reveals a deletion within the hypervariable region of the S1 subunit of the spike glycoprotein also found in human coronavirus OC43 |
Journal: Arch Virol 151 (9); 1735-1748 (2006) |
Taxonomy: Bovine coronavirus Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Embecovirus. |
db_xref: """taxon:11128, CDD:286493""" |
Sequence: TEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGLGIDAGYKNSGIGTCPAGTNYLTCHSLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCTCQPQAFLGWSVDS |
Nucleotide
Nucleotide_Id: AY606195.1 |
Length: 395bp |
Description: Bovine coronavirus strain USP-05 spike protein subunit 1 (S1) gene; partial cds |
Source: Bovine coronavirus |
Nucleotide_type: RNA |
Molecule type: linear |
Data category: VRL |
Date: 26-Jul-16 |
Class virus: Coronaviridae |
Virus name: Bovine coronavirus |
CDS: AY606195.1:<1..>395 |
Host: -- |
Authors: Brandao;P.E.; Gregori;F.; Richtzenhain;L.J.; Rosales;C.A.; Villarreal;L.Y. and Jerez;J.A. |
Journal: Arch Virol 151 (9); 1735-1748 (2006) |
Title: Molecular analysis of Brazilian strains of bovine coronavirus (BCoV) reveals a deletion within the hypervariable region of the S1 subunit of the spike glycoprotein also found in human coronavirus OC43 |
db_xref: taxon:11128 |
Taxonomy: Bovine coronavirus Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Embecovirus. |
Features: SeqFeature(FeatureLocation(ExactPosition(0); ExactPosition(395); strand=1); type='source'); SeqFeature(FeatureLocation(BeforePosition(0); AfterPosition(395); strand=1); type='gene'); SeqFeature(FeatureLocation(BeforePosition(0); AfterPosition(395); strand=1); type='CDS') |
Sequence: TACAGAACAATCTGTTTTTAAGCCTCAACCTGTAGGTGTTTTTACTCATCATGATGTTGTTTATGCACAACATTGTTTTAAAGCTCCCACAAATTTCTGTCCGTGTAAATTGGATGGGTCTTTGTGTGTAGGTAATGGTCTTGGTATAGATGCTGGTTATAAAAATAGTGGTATAGGCACTTGTCCTGCAGGTACTAATTATTTAACTTGCCATAGTTTGTGCACTCCCGACCCCATTACATCTAAATCTACAGGGCCTTACAAGTGCCCCCAAACTAAATACTTAGTTGGCATAGGTGAGCACTGTTCGGGTCTTGCTATTAAAAGTGATTATTGTGGAGGTAATCCTTGTACTTGCCAACCACAAGCATTTTTGGGTTGGTCTGTTGACTCTT |